PDB entry 197l

View 197l on RCSB PDB site
Description: thermodynamic and structural compensation in "size-switch" core-repacking variants of t4 lysozyme
Class: hydrolase (o-glycosyl)
Keywords: cavities, core-packing, protein stability, hydrolase (o-glycosyl)
Deposited on 1995-11-06, released 1996-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-End)
      • conflict (53)
      • conflict (96)
      • conflict (128)
      • conflict (152)
    Domains in SCOPe 2.07: d197la_
  • Heterogens: CL, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >197lA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdemavnlaksrwynqtpnrakrvittartgtwdayknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >197lA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdemavnlaksrwynqtpnrakrvittartgtwdayk