PDB entry 1914

View 1914 on RCSB PDB site
Description: signal recognition particle alu rna binding heterodimer, srp9/14
Deposited on 1997-11-13, released 1998-12-30
The last revision prior to the SCOP 1.65 freeze date was dated 1999-05-11, with a file datestamp of 1999-05-11.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.248
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >1914_ (-)
    masmtggqqmgripgnsprmvlleseqflteltrlfqkcrssgsvfitlkkydgrtkpip
    rkssveglepaenkcllratdgkrkistvvsskevnkfqmaysnllranmdglkkrdkkn
    kskkskpaqggeqkliseeddsagspmpqfqtweefsraaeklyladpmkvrvvlkyrhv
    dgnlcikvtddlvclvyrtdqaqdvkkiekfhsqlmrlmvakesrnvtmete
    

    Sequence, based on observed residues (ATOM records): (download)
    >1914_ (-)
    mvlleseqflteltrlfqkcrssgsvfitlkkydeglepaenkcllratdgkrkistvvs
    skevnkfqmaysnllranmdglkkraqggeqklfqtweefsraaeklyladpmkvrvvlk
    yrhvdgnlcikvtddlvclvyrtdqaqdvkkiekfhsqlmrlmvakesrnv