PDB entry 1914

View 1914 on RCSB PDB site
Description: signal recognition particle alu RNA binding heterodimer, srp9/14
Class: alu domain
Keywords: alu domain, RNA binding, signal recognition particle (srp), translation regulation
Deposited on 1997-11-13, released 1998-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.248
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: signal recognition particle 9/14 fusion protein
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1914a1, d1914a2
  • Heterogens: PO4, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1914A (A:)
    masmtggqqmgripgnsprmvlleseqflteltrlfqkcrssgsvfitlkkydgrtkpip
    rkssveglepaenkcllratdgkrkistvvsskevnkfqmaysnllranmdglkkrdkkn
    kskkskpaqggeqkliseeddsagspmpqfqtweefsraaeklyladpmkvrvvlkyrhv
    dgnlcikvtddlvclvyrtdqaqdvkkiekfhsqlmrlmvakesrnvtmete
    

    Sequence, based on observed residues (ATOM records): (download)
    >1914A (A:)
    mvlleseqflteltrlfqkcrssgsvfitlkkydeglepaenkcllratdgkrkistvvs
    skevnkfqmaysnllranmdglkkraqggeqklfqtweefsraaeklyladpmkvrvvlk
    yrhvdgnlcikvtddlvclvyrtdqaqdvkkiekfhsqlmrlmvakesrnv