PDB entry 189l

View 189l on RCSB PDB site
Description: enhancement of protein stability by the combination of point mutations in t4 lysozyme is additive
Deposited on 1995-05-09, released 1995-07-31
The last revision prior to the SCOP 1.55 freeze date was dated 1995-07-31, with a file datestamp of 1995-08-14.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.2
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d189l__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >189l_ (-)
    mnlfemlrideglrlkiykdtegyytigighlltkspdlnvakseldkaigrncngvitk
    deaeklfnqdvdaavrgilrnpklkpvydsldavrrcalinmvfqmgetgvagftdslrm
    lqqkrwdeaaanlaksrwynqtpdrakrvittfrtgtwdayknl