PDB entry 183l

View 183l on RCSB PDB site
Description: specificity of ligand binding in a buried non-polar cavity of t4 lysozyme: linkage of dynamics and structural plasticity
Deposited on 1995-04-19, released 1995-07-10
The last revision prior to the SCOP 1.55 freeze date was dated 1995-07-10, with a file datestamp of 1995-07-11.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.177
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d183l__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >183l_ (-)
  mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrraaainmvfqmgetgvagftnslrm
  lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk