PDB entry 17gs

View 17gs on RCSB PDB site
Description: glutathione s-transferase p1-1
Class: transferase
Keywords: glutathione transferase, k54a mutant, detoxification
Deposited on 1997-12-07, released 1998-12-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.174
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09211 (1-209)
      • engineered (54)
    Domains in SCOPe 2.07: d17gsa1, d17gsa2
  • Chain 'B':
    Compound: glutathione s-transferase
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTP1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P09211 (Start-209)
      • engineered (54)
    Domains in SCOPe 2.07: d17gsb1, d17gsb2
  • Heterogens: GTX, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >17gsA (A:)
    mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpafqdgd
    ltlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyv
    kalpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsay
    vgrlsarpklkaflaspeyvnlpingngkq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >17gsB (B:)
    mppytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpafqdgd
    ltlyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyv
    kalpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsay
    vgrlsarpklkaflaspeyvnlpingngkq
    

    Sequence, based on observed residues (ATOM records): (download)
    >17gsB (B:)
    pytvvyfpvrgrcaalrmlladqgqswkeevvtvetwqegslkasclygqlpafqdgdlt
    lyqsntilrhlgrtlglygkdqqeaalvdmvndgvedlrckyisliytnyeagkddyvka
    lpgqlkpfetllsqnqggktfivgdqisfadynlldlllihevlapgcldafpllsayvg
    rlsarpklkaflaspeyvnlpingngkq