PDB entry 179l

View 179l on RCSB PDB site
Description: protein flexibility and adaptability seen in 25 crystal forms of t4 lysozyme
Deposited on 1995-03-24, released 1995-07-10
The last revision prior to the SCOP 1.55 freeze date was dated 1995-07-10, with a file datestamp of 1995-07-11.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.232
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d179l__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >179l_ (-)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
lqqkrwceaavnlaksrwynqtpnrakrvittfctgtwdayk