PDB entry 173l

View 173l on RCSB PDB site
Description: protein flexibility and adaptability seen in 25 crystal forms of t4 lysozyme
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1995-03-24, released 1995-07-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: N/A
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t4 lysozyme
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-End)
      • conflict (15)
      • conflict (118)
      • conflict (134)
      • conflict (146)
    Domains in SCOPe 2.07: d173la_
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >173lA (A:)
    mnifemlrideglrleiykdtegyytigighlltkspslnaakseldkaigrncngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslem
    lqqkrwdeaavnlaesrwynqtpnraervittfrtgtwdayknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >173lA (A:)
    mnifemlrideglrleiykdtegyytigighlltkspslnaakseldkaigrncngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslem
    lqqkrwdeaavnlaesrwynqtpnraervittfrtgtwdayk