PDB entry 172l

View 172l on RCSB PDB site
Description: protein flexibility and adaptability seen in 25 crystal forms of t4 lysozyme
Class: hydrolase (o-glycosyl)
Keywords: hydrolase (o-glycosyl)
Deposited on 1995-03-24, released 1995-07-10
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.19
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t4 lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • conflict (2)
    Domains in SCOPe 2.03: d172la_
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >172lA (A:)
    mncfemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl