PDB entry 16vp

View 16vp on RCSB PDB site
Description: conserved core of the herpes simplex virus transcriptional regulatory protein vp16
Class: transcriptional regulatory protein
Keywords: transcriptional regulatory protein
Deposited on 1999-02-11, released 1999-07-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.192
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (vp16, vmw65, atif)
    Species: Human herpesvirus 1 [TaxId:10298]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P06492 (0-End)
      • see remark 999 (0-1)
    Domains in SCOPe 2.07: d16vpa_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >16vpA (A:)
    srmpsppmpvppaalfnrllddlgfsagpalctmldtwnedlfsalptnadlyreckfls
    tlpsdvvewgdayvpertqidirahgdvafptlpatrdglglyyealsrffhaelraree
    syrtvlanfcsalyrylrasvrqlhrqahmrgrdrdlgemlratiadryyretarlarvl
    flhlylfltreilwaayaeqmmrpdlfdclccdleswrqlaglfqpfmfvngaltvrgvp
    iearrlrelnhirehlnlplvrsaateepgaplttpptlhgnqarasgyfmvliraklds
    yssfttspseavmrehaysraptknnygstieglldlpdddapeeaglaaprlsflpagh
    trrlst
    

    Sequence, based on observed residues (ATOM records): (download)
    >16vpA (A:)
    srmpsppmpvppaalfnrllddlgfsagpalctmldtwnedlfsalptnadlyreckfls
    tlpsdvvewgdayvpertqidirahgdvafptlpatrdglglyyealsrffhaelraree
    syrtvlanfcsalyrylrasvrqlhrqahmrgrdrdlgemlratiadryyretarlarvl
    flhlylfltreilwaayaeqmmrpdlfdclccdleswrqlaglfqpfmfvngaltvrgvp
    iearrlrelnhirehlnlplvrsaateepgaplttpptlhgnqarasgyfmvliraklds
    yssaaprlsfl