PDB entry 16pk

View 16pk on RCSB PDB site
Description: phosphoglycerate kinase from trypanosoma brucei bisubstrate analog
Class: kinase
Keywords: kinase, phosphoglycerate, ternary complex, glycolysis, transferase, bisubstrate, analog
Deposited on 1998-05-18, released 1998-11-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.188
AEROSPACI score: 0.58 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoglycerate kinase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07378 (0-414)
      • conflict (93)
      • conflict (413)
    Domains in SCOPe 2.07: d16pka_
  • Heterogens: BIS, EPE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >16pkA (A:)
    ekksinecdlkgkkvlirvdfnvpvkngkitndyrirsalptlkkvlteggscvlmshlg
    rpkgipmaqagkirstggvpgfqqkatlkpvakrlselllrpvtfapdclnaadvvskms
    pgdvvllenvrfykeegskkakdreamakilasygdvyisdafgtahrdsatmtgipkil
    gngaagylmekeisyfakvlgnpprplvaivggakvsdkiqlldnmlqridylliggama
    ytflkaqgysigkskceesklefarsllkkaedrkvqvilpidhvchtefkavdsplite
    dqnipeghmaldigpktiekyvqtigkcksaiwngpmgvfemvpyskgtfaiakamgrgt
    hehglmsiigggdsasaaelsgeakrmshvstgggaslellegktlpgvtvlddk