PDB entry 15c8

View 15c8 on RCSB PDB site
Description: catalytic antibody 5c8, free fab
Class: catalytic antibody
Keywords: catalytic antibody, fab, ring closure reaction
Deposited on 1998-03-18, released 1999-03-23
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.19
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'H':
    Compound: igg 5c8 fab (heavy chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01869 (1-216)
      • conflict (2)
      • conflict (4-5)
      • conflict (13)
      • conflict (39)
      • conflict (48-49)
      • conflict (56-57)
      • conflict (66)
      • conflict (75)
      • conflict (81)
      • conflict (90)
      • conflict (96-103)
      • conflict (103)
      • conflict (106)
    Domains in SCOPe 2.03: d15c8h1, d15c8h2
  • Chain 'L':
    Compound: igg 5c8 fab (light chain)
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01837 (1-212)
      • conflict (32)
      • conflict (94)
      • conflict (96)
    Domains in SCOPe 2.03: d15c8l1, d15c8l2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'H':
    Sequence; same for both SEQRES and ATOM records: (download)
    >15c8H (H:)
    evqlqqsgaelvkpgasvklsctasgfnikdtymhwvkqkpeqglewiaqidpangntky
    dpkfqgkatitadtssntaylhlssltsedsavyycaadppyyghgdywgqgttltvssa
    kttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsdl
    ytlsssvtvpsstwpsetvtcnvahpasstkvdkkiv
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >15c8L (L:)
    divltqspaimsaslgervtmtctasssvsssnlhwyqqkpgsspklwiystsnlasgvp
    arfsgsgsgtsysltissmeaedaatyychqyhrspytfgggtkleikradaaptvsifp
    psseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqdskdstysmsstl
    tltkdeyerhnsytceathktstspivksfnrn