PDB entry 156b

View 156b on RCSB PDB site
Description: improvement of the 2.5 angstroms resolution model of cytochrome $b=562= by redetermining the primary structure and using molecular graphics
Deposited on 1979-07-30, released 1979-09-11
The last revision was dated 1991-01-15, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: HEM

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >156b_ (-)
    adleddmqtlndnlkviekabbzkandaalvkmraaalnaqkatppklednsqpmkdfrh
    gfdilvegiddalklanegkvkeaqaaaeqlkttrnayhqkyr
    

  • Chain 'p':
    No sequence available.