PDB entry 152l

View 152l on RCSB PDB site
Description: conservation of solvent-binding sites in 10 crystal forms of t4 lysozyme
Deposited on 1994-01-26, released 1994-05-31
The last revision prior to the SCOP 1.69 freeze date was dated 1994-05-31, with a file datestamp of 1994-06-07.
Experiment type: -
Resolution: 2 Å
R-factor: 0.168
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d152l__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >152l_ (-)
mncfemlrcdeglrlkiykdcegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqcpnrakrvittfrtgtwdayknc