PDB entry 151c

View 151c on RCSB PDB site
Description: pseudomonas cytochrome c=551= at 2.0 angstroms resolution. enlargement of the cytochrome c family
Deposited on 1978-08-08, released 1978-08-08
The last revision was dated 1978-08-08, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: N/A
R-factor: N/A
AEROSPACI score: -0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: HEM

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >151c_ (-)
edpevlfknkgcvachaidtkmvgpaykdvaakfagqagaeaevaqrikngsqgvwgpip
mppnavsddeaqtlakwvlsqk

  • Chain 'p':
    No sequence available.