PDB entry 149l

View 149l on RCSB PDB site
Description: conservation of solvent-binding sites in 10 crystal forms of t4 lysozyme
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1994-01-25, released 1994-04-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: t4 lysozyme
  Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00720 (0-163)
    • conflict (2)
  Domains in SCOPe 2.08: d149la_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >149lA (A:)
  mnlfemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrrcalinmvfqmgetgvagftnslrm
  lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl