PDB entry 141l

View 141l on RCSB PDB site
Description: role of backbone flexibility in the accommodation of variants that repack the core of t4 lysozyme
Deposited on 1993-10-15, released 1994-01-31
The last revision prior to the SCOP 1.55 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2 Å
R-factor: 0.153
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d141l__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >141l_ (-)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
aqqkrwdemavnlaksrwynqtpnrakriittfrtgtwdayk