PDB entry 13pk

View 13pk on RCSB PDB site
Description: ternary complex of phosphoglycerate kinase from trypanosoma brucei
Class: kinase
Keywords: kinase, phosphoglycerate, ternary complex, glycolysis, transferase
Deposited on 1996-11-23, released 1997-12-24
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.221
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-phosphoglycerate kinase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07378 (0-414)
      • conflict (93)
      • conflict (413)
    Domains in SCOPe 2.07: d13pka_
  • Chain 'B':
    Compound: 3-phosphoglycerate kinase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07378 (0-414)
      • conflict (93)
      • conflict (413)
    Domains in SCOPe 2.07: d13pkb_
  • Chain 'C':
    Compound: 3-phosphoglycerate kinase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07378 (0-414)
      • conflict (93)
      • conflict (413)
    Domains in SCOPe 2.07: d13pkc_
  • Chain 'D':
    Compound: 3-phosphoglycerate kinase
    Species: Trypanosoma brucei [TaxId:5691]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07378 (0-414)
      • conflict (93)
      • conflict (413)
    Domains in SCOPe 2.07: d13pkd_
  • Heterogens: MG, PO4, ADP, 3PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >13pkA (A:)
    ekksinecdlkgkkvlirvdfnvpvkngkitndyrirsalptlkkvlteggscvlmshlg
    rpkgipmaqagkirstggvpgfqqkatlkpvakrlselllrpvtfapdclnaadvvskms
    pgdvvllenvrfykeegskkakdreamakilasygdvyisdafgtahrdsatmtgipkil
    gngaagylmekeisyfakvlgnpprplvaivggakvsdkiqlldnmlqridylliggama
    ytflkaqgysigkskceesklefarsllkkaedrkvqvilpidhvchtefkavdsplite
    dqnipeghmaldigpktiekyvqtigkcksaiwngpmgvfemvpyskgtfaiakamgrgt
    hehglmsiigggdsasaaelsgeakrmshvstgggaslellegktlpgvtvlddk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >13pkB (B:)
    ekksinecdlkgkkvlirvdfnvpvkngkitndyrirsalptlkkvlteggscvlmshlg
    rpkgipmaqagkirstggvpgfqqkatlkpvakrlselllrpvtfapdclnaadvvskms
    pgdvvllenvrfykeegskkakdreamakilasygdvyisdafgtahrdsatmtgipkil
    gngaagylmekeisyfakvlgnpprplvaivggakvsdkiqlldnmlqridylliggama
    ytflkaqgysigkskceesklefarsllkkaedrkvqvilpidhvchtefkavdsplite
    dqnipeghmaldigpktiekyvqtigkcksaiwngpmgvfemvpyskgtfaiakamgrgt
    hehglmsiigggdsasaaelsgeakrmshvstgggaslellegktlpgvtvlddk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >13pkC (C:)
    ekksinecdlkgkkvlirvdfnvpvkngkitndyrirsalptlkkvlteggscvlmshlg
    rpkgipmaqagkirstggvpgfqqkatlkpvakrlselllrpvtfapdclnaadvvskms
    pgdvvllenvrfykeegskkakdreamakilasygdvyisdafgtahrdsatmtgipkil
    gngaagylmekeisyfakvlgnpprplvaivggakvsdkiqlldnmlqridylliggama
    ytflkaqgysigkskceesklefarsllkkaedrkvqvilpidhvchtefkavdsplite
    dqnipeghmaldigpktiekyvqtigkcksaiwngpmgvfemvpyskgtfaiakamgrgt
    hehglmsiigggdsasaaelsgeakrmshvstgggaslellegktlpgvtvlddk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >13pkD (D:)
    ekksinecdlkgkkvlirvdfnvpvkngkitndyrirsalptlkkvlteggscvlmshlg
    rpkgipmaqagkirstggvpgfqqkatlkpvakrlselllrpvtfapdclnaadvvskms
    pgdvvllenvrfykeegskkakdreamakilasygdvyisdafgtahrdsatmtgipkil
    gngaagylmekeisyfakvlgnpprplvaivggakvsdkiqlldnmlqridylliggama
    ytflkaqgysigkskceesklefarsllkkaedrkvqvilpidhvchtefkavdsplite
    dqnipeghmaldigpktiekyvqtigkcksaiwngpmgvfemvpyskgtfaiakamgrgt
    hehglmsiigggdsasaaelsgeakrmshvstgggaslellegktlpgvtvlddk