PDB entry 135l

View 135l on RCSB PDB site
Description: x-ray structure of monoclinic turkey egg lysozyme at 1.3 angstroms resolution
Deposited on 1993-06-10, released 1993-10-31
The last revision prior to the SCOP 1.69 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.3 Å
R-factor: 0.189
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d135l__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >135l_ (-)
    kvygrcelaaamkrlgldnyrgyslgnwvcaakfesnfnthatnrntdgstdygilqins
    rwwcndgrtpgsknlcnipcsallssditasvncakkiasggngmnawvawrnrckgtdv
    hawirgcrl