PDB entry 134l

View 134l on RCSB PDB site
Description:
Deposited on 1993-06-01, released 1993-10-31
The last revision prior to the SCOP 1.63 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.77 Å
R-factor: 0.183
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d134l__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >134l_ (-)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnecqnrd
    vrqyvqgcgv