PDB entry 134l

View 134l on RCSB PDB site
Description: role of arg 115 in the catalytic action of human lysozyme. x-ray structure of his 115 and glu 115 mutants
Deposited on 1993-06-01, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.77 Å
R-factor: 0.183
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

• Chain ' ':
  Domains in SCOP 1.55: d134l__

PDB Chain Sequences:

• Chain ' ':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >134l_ (-)
  kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
  srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnecqnrd
  vrqyvqgcgv