PDB entry 133l

View 133l on RCSB PDB site
Description: role of arg 115 in the catalytic action of human lysozyme. x-ray structure of his 115 and glu 115 mutants
Deposited on 1993-06-01, released 1993-10-31
The last revision prior to the SCOP 1.57 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.77 Å
R-factor: 0.181
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d133l__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >133l_ (-)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnhcqnrd
    vrqyvqgcgv