PDB entry 12as

View 12as on RCSB PDB site
Description: asparagine synthetase mutant c51a, c315a complexed with l-asparagine and amp
Class: ligase
Keywords: ligase, asparagine synthetase, nitrogen fixation
Deposited on 1997-12-02, released 1998-12-30
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.164
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: asparagine synthetase
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: ASNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00963 (Start-329)
      • engineered (50)
      • engineered (314)
    Domains in SCOPe 2.06: d12asa_
  • Chain 'B':
    Compound: asparagine synthetase
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: ASNA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00963 (Start-329)
      • engineered (50)
      • engineered (314)
    Domains in SCOPe 2.06: d12asb_
  • Heterogens: ASN, AMP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >12asA (A:)
    mktayiakqrqisfvkshfsrqleerlglievqapilsrvgdgtqdnlsgaekavqvkvk
    alpdaqfevvhslakwkrqtlgqhdfsageglythmkalrpdedrlsplhsvyvdqwdwe
    rvmgdgerqfstlkstveaiwagikateaavseefglapflpdqihfvhsqellsrypdl
    dakgreraiakdlgavflvgiggklsdghrhdvrapdyddwstpselghaglngdilvwn
    pvledafelssmgirvdadtlkhqlaltgdedrlelewhqallrgempqtigggigqsrl
    tmlllqlphigqvqagvwpaavresvpsll
    

    Sequence, based on observed residues (ATOM records): (download)
    >12asA (A:)
    ayiakqrqisfvkshfsrqleerlglievqapilsrvgdgtqdnlsgaekavqvkvkalp
    daqfevvhslakwkrqtlgqhdfsageglythmkalrpdedrlsplhsvyvdqwdwervm
    gdgerqfstlkstveaiwagikateaavseefglapflpdqihfvhsqellsrypdldak
    greraiakdlgavflvgiggklsdghrhdvrapdyddwstpselghaglngdilvwnpvl
    edafelssmgirvdadtlkhqlaltgdedrlelewhqallrgempqtigggigqsrltml
    llqlphigqvqagvwpaavresvpsll
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >12asB (B:)
    mktayiakqrqisfvkshfsrqleerlglievqapilsrvgdgtqdnlsgaekavqvkvk
    alpdaqfevvhslakwkrqtlgqhdfsageglythmkalrpdedrlsplhsvyvdqwdwe
    rvmgdgerqfstlkstveaiwagikateaavseefglapflpdqihfvhsqellsrypdl
    dakgreraiakdlgavflvgiggklsdghrhdvrapdyddwstpselghaglngdilvwn
    pvledafelssmgirvdadtlkhqlaltgdedrlelewhqallrgempqtigggigqsrl
    tmlllqlphigqvqagvwpaavresvpsll
    

    Sequence, based on observed residues (ATOM records): (download)
    >12asB (B:)
    ayiakqrqisfvkshfsrqleerlglievqapilsrvgdgtqdnlsgaekavqvkvkalp
    daqfevvhslakwkrqtlgqhdfsageglythmkalrpdedrlsplhsvyvdqwdwervm
    gdgerqfstlkstveaiwagikateaavseefglapflpdqihfvhsqellsrypdldak
    greraiakdlgavflvgiggklsdghrhdvrapdyddwstpselghaglngdilvwnpvl
    edafelssmgirvdadtlkhqlaltgdedrlelewhqallrgempqtigggigqsrltml
    llqlphigqvqagvwpaavresvpsll