PDB entry 125d

View 125d on RCSB PDB site
Description: solution structure of the dna-binding domain of cd=2=-gal4 from s. cerevisiae
Deposited on 1993-05-05, released 1994-01-31
The last revision was dated 1994-01-31, with a file datestamp of 2007-04-25.
Experiment type: NMR22
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    no info in PDB for this chain
  • Chain 'p':
    no info in PDB for this chain
  • Heterogens: CD

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records:
    >125d_ (-)
    mkllssieqacdicrlkklkcskekpkcakclknnwecryspk
    

  • Chain 'p':
    No sequence available.