PDB entry 11bg

View 11bg on RCSB PDB site
Description: a potential allosteric subsite generated by domain swapping in bovine seminal ribonuclease
Deposited on 1999-03-11, released 1999-11-05
The last revision prior to the SCOP 1.55 freeze date was dated 1999-11-05, with a file datestamp of 1999-11-04.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.189
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.55: d11bga_
  • Chain 'B':
    Domains in SCOP 1.55: d11bgb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >11bgA (A:)
    kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
    kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
    dasv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >11bgB (B:)
    kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
    kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
    dasv