PDB entry 11ba

View 11ba on RCSB PDB site
Description: binding of a substrate analogue to a domain swapping protein in the complex of bovine seminal ribonuclease with uridylyl-2',5'-adenosine
Class: hydrolase
Keywords: hydrolase, phosphoric diester, RNA, 2'-5'-dinucleotide
Deposited on 1999-03-17, released 1999-03-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-04, with a file datestamp of 2017-09-29.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ribonuclease, seminal)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00669 (0-123)
    • GB S81747 (0-123)
    Domains in SCOPe 2.07: d11baa_
  • Chain 'B':
    Compound: protein (ribonuclease, seminal)
    Species: Bos taurus [TaxId:9913]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00669 (0-123)
    • GB S81747 (0-123)
    Domains in SCOPe 2.07: d11bab_
  • Heterogens: SO4, UPA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >11baA (A:)
    kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
    kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
    dasv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >11baB (B:)
    kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
    kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
    dasv