PDB entry 11ba

View 11ba on RCSB PDB site
Description: binding of a substrate analogue to a domain swapping protein in the complex of bovine seminal ribonuclease with uridylyl-2',5'-adenosine
Class: hydrolase
Keywords: hydrolase, phosphoric diester, RNA, 2'-5'-dinucleotide
Deposited on 1999-03-17, released 1999-03-26
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-11-06, with a file datestamp of 2019-11-01.
Experiment type: XRAY
Resolution: 2.06 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: protein (ribonuclease, seminal)
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00669 (0-123)
  • GB S81747 (0-123)
  Domains in SCOPe 2.08: d11baa_
• Chain 'B':
  Compound: protein (ribonuclease, seminal)
  Species: Bos taurus [TaxId:9913]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00669 (0-123)
  • GB S81747 (0-123)
  Domains in SCOPe 2.08: d11bab_
• Heterogens: SO4, UPA, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >11baA (A:)
  kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
  kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
  dasv
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >11baB (B:)
  kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
  kkvtckngqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
  dasv