PDB entry 118l

View 118l on RCSB PDB site
Description: the energetic cost and the structural consequences of burying a hydroxyl group within the core of a protein determined from ala to ser and val to thr substitutions in t4 lysozyme
Deposited on 1993-05-28, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 1.8 Å
R-factor: 0.146
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d118l__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >118l_ (-)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeasvnlaksrwynqtpnrakrvittfrtgtwdayk