PDB entry 116l

View 116l on RCSB PDB site
Description: structural basis of alpha-helix propensity at two sites in t4 lysozyme
Deposited on 1993-01-05, released 1993-10-31
The last revision was dated 1994-07-31, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.172
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    no info in PDB for this chain
  • Chain 'B':
    no info in PDB for this chain
  • Chain 'C':
    no info in PDB for this chain
  • Chain 'D':
    no info in PDB for this chain
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >116lA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakweldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl
    

    Sequence, based on observed residues (ATOM records):
    >116lA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakweldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >116lB (B:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakweldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >116lC (C:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakweldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >116lD (D:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakweldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl
    

    Sequence, based on observed residues (ATOM records):
    >116lD (D:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaakweldkaigrntngvitk
    deaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslrm
    lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk