PDB entry 112m

View 112m on RCSB PDB site
Description: sperm whale myoglobin d122n n-propyl isocyanide at ph 9.0
Deposited on 1997-12-24, released 1998-04-08
The last revision prior to the SCOP 1.69 freeze date was dated 1999-05-17, with a file datestamp of 1999-05-16.
Experiment type: XRAY
Resolution: 2.34 Å
R-factor: 0.155
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.69: d112m__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >112m_ (-)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg