PDB entry 111m

View 111m on RCSB PDB site
Description: sperm whale myoglobin d122n n-butyl isocyanide at ph 9.0
Deposited on 1997-12-24, released 1998-04-08
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-17, with a file datestamp of 1999-05-16.
Experiment type: XRAY
Resolution: 1.88 Å
R-factor: 0.165
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d111m__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >111m_ (-)
    mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
    dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
    pgnfgadaqgamnkalelfrkdiaakykelgyqg