PDB entry 10mh

View 10mh on RCSB PDB site
Description: ternary structure of hhai methyltransferase with adohcy and hemimethylated DNA containing 5,6-dihydro-5-azacytosine at the target
Class: transferase/DNA
Keywords: transferase, methyltransferase, restriction system, complex (methyltransferase/ DNA), transferase/DNA complex
Deposited on 1998-08-10, released 1999-02-09
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.205
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (cytosine-specific methyltransferase hhai)
    Species: Haemophilus haemolyticus [TaxId:726]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d10mha_
  • Chain 'B':
    Compound: DNA (5'-d(p*cp*cp*ap*tp*gp*(5cm)p*gp*cp*tp*gp*ap*c)-3')
  • Chain 'C':
    Compound: DNA (5'-d(p*gp*tp*cp*ap*gp*5ncp*gp*cp*ap*tp*gp*g)-3')
  • Heterogens: SAH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >10mhA (A:)
mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
qfgnsvvinvlqyiaynigsslnfkpy

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.