PDB entry 10mh

View 10mh on RCSB PDB site
Description: ternary structure of hhai methyltransferase with adohcy and hemimethylated dna containing 5,6-dihydro-5-azacytosine at the target
Deposited on 1998-08-10, released 1999-02-09
The last revision prior to the SCOP 1.61 freeze date was dated 2000-06-20, with a file datestamp of 2000-06-20.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.205
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.61: d10mha_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >10mhA (A:)
    mieikdkqltglrfidlfaglggfrlalescgaecvysnewdkyaqevyemnfgekpegd
    itqvnektipdhdilcagfpcqafsisgkqkgfedsrgtlffdiarivrekkpkvvfmen
    vknfashdngntlevvkntmneldysfhakvlnaldygipqkreriymicfrndlniqnf
    qfpkpfelntfvkdlllpdsevehlvidrkdlvmtnqeieqttpktvrlgivgkggqger
    iystrgiaitlsaygggifaktggylvngktrklhprecarvmgypdsykvhpstsqayk
    qfgnsvvinvlqyiaynigsslnfkpy