PDB entry 104l

View 104l on RCSB PDB site
Description: how amino-acid insertions are allowed in an alpha-helix of t4 lysozyme
Class: hydrolase(o-glycosyl)
Keywords: hydrolase(o-glycosyl)
Deposited on 1992-09-29, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.8 Å
R-factor: 0.175
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: t4 lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-End)
      • insertion (43)
      • conflict (55)
      • conflict (98)
    Domains in SCOPe 2.07: d104la_
  • Chain 'B':
    Compound: t4 lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-End)
      • insertion (43)
      • conflict (55)
      • conflict (98)
    Domains in SCOPe 2.07: d104lb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >104lA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaaksaaeldkaigrntngvi
    tkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnsl
    rmlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >104lA (A:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaaksaaeldkaigrntngvi
    tkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnsl
    rmlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >104lB (B:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaaksaaeldkaigrntngvi
    tkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnsl
    rmlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl
    

    Sequence, based on observed residues (ATOM records): (download)
    >104lB (B:)
    mnifemlrideglrlkiykdtegyytigighlltkspslnaaksaaeldkaigrntngvi
    tkdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnsl
    rmlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk