PDB entry 102m

View 102m on RCSB PDB site
Description: sperm whale myoglobin h64a aquomet at ph 9.0
Deposited on 1997-12-15, released 1998-04-08
The last revision prior to the SCOP 1.55 freeze date was dated 1999-05-17, with a file datestamp of 1999-05-16.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: 0.159
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d102m__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >102m_ (-)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkase
dlkkagvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg