PDB entry 102l

View 102l on RCSB PDB site
Description: how amino-acid insertions are allowed in an alpha-helix of t4 lysozyme
Deposited on 1992-09-29, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1995-01-15, with a file datestamp of 1995-01-19.
Experiment type: -
Resolution: 1.74 Å
R-factor: 0.174
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d102l__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >102l_ (-)
mnifemlrideglrlkiykdtegyytigighlltkspslnaaakseldkaigrntngvit
kdeaeklfnqdvdaavrgilrnaklkpvydsldavrraalinmvfqmgetgvagftnslr
mlqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayk