PDB entry 101m

View 101m on RCSB PDB site
Description: sperm whale myoglobin f46v n-butyl isocyanide at ph 9.0
Deposited on 1997-12-13, released 1998-04-08
The last revision prior to the SCOP 1.65 freeze date was dated 1999-05-17, with a file datestamp of 1999-05-16.
Experiment type: XRAY
Resolution: 2.07 Å
R-factor: 0.157
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.65: d101m__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >101m_ (-)
mvlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrvkhlkteaemkase
dlkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrh
pgnfgadaqgamnkalelfrkdiaakykelgyqg