PDB entry 05c1

View 05c1 on RCSB PDB site
Description: electron transport (heme protein)
Deposited on 1994-01-31, released 1994-01-31
Made obsolete on 2007-09-27

The last revision prior to the SCOP 1.57 freeze date was dated 1994-01-31, with a file datestamp of 1994-01-31.
No data on structure quality are available

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.57: d05c1__

PDB Chain Sequences:

  • Chain ' ':
    Sequence, based on SEQRES records: (download)
    >05c1_ (-)
    ydaaagkatydascamchktgmmgapkvgdkaawaphiakgmnvmvansikgykgtkgmm
    pakggnpkltdaqvgnavaymvgqsk