SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

PDB entry 3cu7

View 3cu7 on RCSB PDB site
Description: Human Complement Component 5
Class: Immune System
Keywords: MG domain, complement, inflammation, anaphylatoxin, Cleavage on pair of basic residues, Complement alternate pathway, Complement pathway, Cytolysis, Glycoprotein, Immune response, Inflammatory response, Innate immunity, Membrane attack complex, Secreted, Immune System
Deposited on 2008-04-16, released 2008-06-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2013-11-06, with a file datestamp of 2013-11-01.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.238
AEROSPACI score: 0.12 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3cu7A (A:)
    mgllgilcfliflgktwgqeqtyvisapkifrvgaseniviqvygyteafdatisiksyp
    dkkfsyssghvhlssenkfqnsailtiqpkqlpggqnpvsyvylevvskhfskskrmpit
    ydngflfihtdkpvytpdqsvkvrvyslnddlkpakretvltfidpegsevdmveeidhi
    giisfpdfkipsnprygmwtikakykedfsttgtayfevkeyvlphfsvsiepeynfigy
    knfknfeitikaryfynkvvteadvyitfgiredlkddqkemmqtamqntmlingiaqvt
    fdsetavkelsyysledlnnkylyiavtviestggfseeaeipgikyvlspyklnlvatp
    lflkpgipypikvqvkdsldqlvggvpvtlnaqtidvnqetsdldpsksvtrvddgvasf
    vlnlpsgvtvlefnvktdapdlpeenqaregyraiaysslsqsylyidwtdnhkallvge
    hlniivtpkspyidkithynylilskgkiihfgtrekfsdasyqsinipvtqnmvpssrl
    lvyyivtgeqtaelvsdsvwlnieekcgnqlqvhlspdadayspgqtvslnmatgmdswv
    alaavdsavygvqrgakkplervfqfleksdlgcgaggglnnanvfhlagltfltnanad
    dsqendepckeilrprrtlqkkieeiaakykhsvvkkccydgacvnndetceqraarisl
    gprcikafteccvvasqlranishkdmqlgrlhmktllpvskpeirsyfpeswlwevhlv
    prrkqlqfalpdslttweiqgigisntgicvadtvkakvfkdvflemnipysvvrgeqiq
    lkgtvynyrtsgmqfcvkmsavegictsespvidhqgtksskcvrqkvegssshlvtftv
    lpleiglhninfsletwfgkeilvktlrvvpegvkresysgvtldprgiygtisrrkefp
    yripldlvpkteikrilsvkgllvgeilsavlsqeginilthlpkgsaeaelmsvvpvfy
    vfhyletgnhwnifhsdpliekqklkkklkegmlsimsyrnadysysvwkggsastwlta
    falrvlgqvnkyveqnqnsicnsllwlvenyqldngsfkensqyqpiklqgtlpvearen
    slyltaftvigirkafdicplvkidtalikadnfllentlpaqstftlaisayalslgdk
    thpqfrsivsalkrealvkgnppiyrfwkdnlqhkdssvpntgtarmvettayalltsln
    lkdinyvnpvikwlseeqrygggfystqdtinaieglteysllvkqlrlsmdidvsykhk
    galhnykmtdknflgrpvevllnddlivstgfgsglatvhvttvvhktstseevcsfylk
    idtqdieashyrgygnsdykrivacasykpsreesssgsshavmdislptgisaneedlk
    alvegvdqlftdyqikdghvilqlnsipssdflcvrfrifelfevgflspatftvyeyhr
    pdkqctmfystsnikiqkvcegaackcveadcgqmqeeldltisaetrkqtackpeiaya
    ykvsitsitvenvfvkykatlldiyktgeavaekdseitfikkvtctnaelvkgrqylim
    gkealqikynfsfryiypldsltwieywprdttcsscqaflanldefaediflngc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cu7A (A:)
    eqtyvisapkifrvgaseniviqvygyteafdatisiksypdkkfsyssghvhlssenkf
    qnsailtiqpkqlpggqnpvsyvylevvskhfskskrmpitydngflfihtdkpvytpdq
    svkvrvyslnddlkpakretvltfidpegsevdmveeidhigiisfpdfkipsnprygmw
    tikakykedfsttgtayfevkeyvlphfsvsiepeynfigyknfknfeitikaryfynkv
    vteadvyitfgiredlkddqkemmqtamqntmlingiaqvtfdsetavkelsyysledln
    nkylyiavtviestggfseeaeipgikyvlspyklnlvatplflkpgipypikvqvkdsl
    dqlvggvpvtlnaqtidvnqetsdldpsksvtrvddgvasfvlnlpsgvtvlefnvktda
    pdlpeenqaregyraiaysslsqsylyidwtdnhkallvgehlniivtpkspyidkithy
    nylilskgkiihfgtrekfsdasyqsinipvtqnmvpssrllvyyivtgeqtaelvsdsv
    wlnieekcgnqlqvhlspdadayspgqtvslnmatgmdswvalaavdsavygvqrgakkp
    lervfqfleksdlgcgaggglnnanvfhlagltfltnanaddsqendepckeillqkkie
    eiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasqlranisl
    grlhmktllpvskpeirsyfpeswlwevhlvprrkqlqfalpdslttweiqgigisntgi
    cvadtvkakvfkdvflemnipysvvrgeqiqlkgtvynyrtsgmqfcvkmsavegictse
    spkcvrqkvegssshlvtftvlpleiglhninfsletwfgkeilvktlrvvpegvkresy
    sgvtldprgiygtisrrkefpyripldlvpkteikrilsvkgllvgeilsavlsqegini
    lthlpkgsaeaelmsvvpvfyvfhyletgnhwnifhsdpliekqklkkklkegmlsimsy
    rnadysysvwkggsastwltafalrvlgqvnkyveqnqnsicnsllwlvenyqldngsfk
    ensqyqpiklqgtlpvearenslyltaftvigirkafdicplvkidtalikadnfllent
    lpaqstftlaisayalslgdkthpqfrsivsalkrealvkgnppiyrfwkdnlqhkdssv
    pntgtarmvettayalltslnlkdinyvnpvikwlseeqrygggfystqdtinaieglte
    ysllvkqlrlsmdidvsykhkgalhnykmtdknflgrpvevllnddlivstgfgsglatv
    hvttvvhktstseevcsfylkidtqdiykrivacasykpsreesssgsshavmdislptg
    isaneedlkalvegvdqlftdyqikdghvilqlnsipssdflcvrfrifelfevgflspa
    tftvyeyhrpdkqctmfystsnikiqkvcegaackcveadcgqmqeeldltisaetrkqt
    ackpeiayaykvsitsitvenvfvkykatlldiyktgeavaekdseitfikkvtctnael
    vkgrqylimgkealqikynfsfryiypldsltwieywprdttcsscqaflanldefaedi
    flngc
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3cu7B (B:)
    mgllgilcfliflgktwgqeqtyvisapkifrvgaseniviqvygyteafdatisiksyp
    dkkfsyssghvhlssenkfqnsailtiqpkqlpggqnpvsyvylevvskhfskskrmpit
    ydngflfihtdkpvytpdqsvkvrvyslnddlkpakretvltfidpegsevdmveeidhi
    giisfpdfkipsnprygmwtikakykedfsttgtayfevkeyvlphfsvsiepeynfigy
    knfknfeitikaryfynkvvteadvyitfgiredlkddqkemmqtamqntmlingiaqvt
    fdsetavkelsyysledlnnkylyiavtviestggfseeaeipgikyvlspyklnlvatp
    lflkpgipypikvqvkdsldqlvggvpvtlnaqtidvnqetsdldpsksvtrvddgvasf
    vlnlpsgvtvlefnvktdapdlpeenqaregyraiaysslsqsylyidwtdnhkallvge
    hlniivtpkspyidkithynylilskgkiihfgtrekfsdasyqsinipvtqnmvpssrl
    lvyyivtgeqtaelvsdsvwlnieekcgnqlqvhlspdadayspgqtvslnmatgmdswv
    alaavdsavygvqrgakkplervfqfleksdlgcgaggglnnanvfhlagltfltnanad
    dsqendepckeilrprrtlqkkieeiaakykhsvvkkccydgacvnndetceqraarisl
    gprcikafteccvvasqlranishkdmqlgrlhmktllpvskpeirsyfpeswlwevhlv
    prrkqlqfalpdslttweiqgigisntgicvadtvkakvfkdvflemnipysvvrgeqiq
    lkgtvynyrtsgmqfcvkmsavegictsespvidhqgtksskcvrqkvegssshlvtftv
    lpleiglhninfsletwfgkeilvktlrvvpegvkresysgvtldprgiygtisrrkefp
    yripldlvpkteikrilsvkgllvgeilsavlsqeginilthlpkgsaeaelmsvvpvfy
    vfhyletgnhwnifhsdpliekqklkkklkegmlsimsyrnadysysvwkggsastwlta
    falrvlgqvnkyveqnqnsicnsllwlvenyqldngsfkensqyqpiklqgtlpvearen
    slyltaftvigirkafdicplvkidtalikadnfllentlpaqstftlaisayalslgdk
    thpqfrsivsalkrealvkgnppiyrfwkdnlqhkdssvpntgtarmvettayalltsln
    lkdinyvnpvikwlseeqrygggfystqdtinaieglteysllvkqlrlsmdidvsykhk
    galhnykmtdknflgrpvevllnddlivstgfgsglatvhvttvvhktstseevcsfylk
    idtqdieashyrgygnsdykrivacasykpsreesssgsshavmdislptgisaneedlk
    alvegvdqlftdyqikdghvilqlnsipssdflcvrfrifelfevgflspatftvyeyhr
    pdkqctmfystsnikiqkvcegaackcveadcgqmqeeldltisaetrkqtackpeiaya
    ykvsitsitvenvfvkykatlldiyktgeavaekdseitfikkvtctnaelvkgrqylim
    gkealqikynfsfryiypldsltwieywprdttcsscqaflanldefaediflngc
    

    Sequence, based on observed residues (ATOM records): (download)
    >3cu7B (B:)
    eqtyvisapkifrvgaseniviqvygyteafdatisiksypdkkfsyssghvhlssenkf
    qnsailtiqpkqlpggqnpvsyvylevvskhfskskrmpitydngflfihtdkpvytpdq
    svkvrvyslnddlkpakretvltfidpegsevdmveeidhigiisfpdfkipsnprygmw
    tikakykedfsttgtayfevkeyvlphfsvsiepeynfigyknfknfeitikaryfynkv
    vteadvyitfgiredlkddqkemmqtamqntmlingiaqvtfdsetavkelsyysledln
    nkylyiavtviestggfseeaeipgikyvlspyklnlvatplflkpgipypikvqvkdsl
    dqlvggvpvtlnaqtidvnqetsdldpsksvtrvddgvasfvlnlpsgvtvlefnvktda
    pdlpeenqaregyraiaysslsqsylyidwtdnhkallvgehlniivtpkspyidkithy
    nylilskgkiihfgtrekfsdasyqsinipvtqnmvpssrllvyyivtgeqtaelvsdsv
    wlnieekcgnqlqvhlspdadayspgqtvslnmatgmdswvalaavdsavygvqrgakkp
    lervfqfleksdlgcgaggglnnanvfhlagltfltnanaddsqendepckeillqkkie
    eiaakykhsvvkkccydgacvnndetceqraarislgprcikafteccvvasqlranisl
    grlhmktllpvskpeirsyfpeswlwevhlvprrkqlqfalpdslttweiqgigisntgi
    cvadtvkakvfkdvflemnipysvvrgeqiqlkgtvynyrtsgmqfcvkmsavegictse
    spkcvrqkvegssshlvtftvlpleiglhninfsletwfgkeilvktlrvvpegvkresy
    sgvtldprgiygtisrrkefpyripldlvpkteikrilsvkgllvgeilsavlsqegini
    lthlpkgsaeaelmsvvpvfyvfhyletgnhwnifhsdpliekqklkkklkegmlsimsy
    rnadysysvwkggsastwltafalrvlgqvnkyveqnqnsicnsllwlvenyqldngsfk
    ensqyqpiklqgtlpvearenslyltaftvigirkafdicplvkidtalikadnfllent
    lpaqstftlaisayalslgdkthpqfrsivsalkrealvkgnppiyrfwkdnlqhkdssv
    pntgtarmvettayalltslnlkdinyvnpvikwlseeqrygggfystqdtinaieglte
    ysllvkqlrlsmdidvsykhkgalhnykmtdknflgrpvevllnddlivstgfgsglatv
    hvttvvhktstseevcsfylkidtqdiykrivacasykpsreesssgsshavmdislptg
    isaneedlkalvegvdqlftdyqikdghvilqlnsipssdflcvrfrifelfevgflspa
    tftvyeyhrpdkqctmfystsnikiqkvcegaackcveadc