SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

PDB entry 2yd0

View 2yd0 on RCSB PDB site
Description: Crystal structure of the soluble domain of human endoplasmic reticulum aminopeptidase 1 ERAP1
Class: hydrolase
Keywords: hydrolase, glycoprotein, metal-binding, metalloprotease, protease, adaptive immunity
Deposited on 2011-03-17, released 2011-04-13
The last revision prior to the SCOPe 2.06 freeze date was dated 2012-10-03, with a file datestamp of 2012-09-28.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.15496
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: endoplasmic reticulum aminopeptidase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2yd0a1, d2yd0a2, d2yd0a3, d2yd0a4
  • Heterogens: NAG, ZN, K, EDO, BES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2yd0A (A:)
    pfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisra
    tlrkgagerlseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfyks
    tyrtkegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksv
    tvaegliedhfdvtvkmstylvafiisdfesvskitksgvkvsvyavpdkinqadyalda
    avtllefyedyfsipyplpkqdlaaipdfqsgamenwglttyresallfdaekssasskl
    gitmtvahelahqwfgnlvtmewwndlwlnegfakfmefvsvsvthpelkvgdyffgkcf
    damevdalnsshpvstpvenpaqiremfddvsydkgacilnmlreylsadafksgivqyl
    qkhsykntknedlwdsmasicptdgvkgmdgfcsrsqhssssshwhqegvdvktmmntwt
    lqkgfplititvrgrnvhmkqehymkgsdgapdtgylwhvpltfitsksdmvhrfllktk
    tdvlilpeevewikfnvgmngyyivhyeddgwdsltgllkgthtavssndraslinnafq
    lvsigklsiekaldlslylkheteimpvfqglnelipmyklmekrdmnevetqfkaflir
    llrdlidkqtwtdegsvsermlrsqllllacvhnyqpcvqraegyfrkwkesngnlslpv
    dvtlavfavgaqstegwdflyskyqfslssteksqiefalcrtqnkeklqwlldesfkgd
    kiktqefpqiltligrnpvgyplawqflrknwnklvqkfelgsssiahmvmgttnqfstr
    trleevkgffsslkengsqlrcvqqtietieenigwmdknfdkirvwlqseklerkk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2yd0A (A:)
    pfpwnkirlpeyvipvhydllihanlttltfwgttkveitasqptstiilhshhlqisra
    tlrkglseeplqvlehprqeqiallapepllvglpytvvihyagnlsetfhgfykstyrt
    kegelrilastqfeptaarmafpcfdepafkasfsikirreprhlaisnmplvksvtvae
    gliedhfdvtvkmstylvafiisdfesvskitksgvkvsvyavpdkinqadyaldaavtl
    lefyedyfsipyplpkqdlaaipdfqsgamenwglttyresallfdaekssassklgitm
    tvahelahqwfgnlvtmewwndlwlnegfakfmefvsvsvthpelkvgdyffgkcfdame
    vdalnsshpvstpvenpaqiremfddvsydkgacilnmlreylsadafksgivqylqkhs
    ykntknedlwdsmasigvdvktmmntwtlqkgfplititvrgrnvhmkqehymkgdtgyl
    whvpltfitsksdmvhrfllktktdvlilpeevewikfnvgmngyyivhyeddgwdsltg
    llkgthtavssndraslinnafqlvsigklsiekaldlslylkheteimpvfqglnelip
    myklmekrdmnevetqfkaflirllrdlidkqtwtdegsvsermlrsqllllacvhnyqp
    cvqraegyfrkwkesngnlslpvdvtlavfavgaqstegwdflyskyqfslssteksqie
    falcrtqnkeklqwlldesfkgdkiktqefpqiltligrnpvgyplawqflrknwnklvq
    kfelgsssiahmvmgttnqfstrtrleevkgffsslkengsqlrcvqqtietieenigwm
    dknfdkirvwlqsekler