SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

PDB entry 2b5l

View 2b5l on RCSB PDB site
Description: Crystal Structure of DDB1 In Complex with Simian Virus 5 V Protein
Class: protein binding/viral protein
Keywords: DDB1, SV5-V, beta propeller, propeller cluster, zinc finger, PROTEIN BINDING/VIRAL PROTEIN COMPLEX
Deposited on 2005-09-28, released 2006-02-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.85 Å
R-factor: 0.229
AEROSPACI score: 0.19 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: damage-specific DNA binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB NP_001914 (0-1139)
    Domains in SCOPe 2.06: d2b5la1, d2b5la2, d2b5la3, d2b5la4
  • Chain 'B':
    Compound: damage-specific DNA binding protein 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • GB NP_001914 (0-1139)
    Domains in SCOPe 2.06: d2b5lb1, d2b5lb2, d2b5lb3, d2b5lb4
  • Chain 'C':
    Compound: Nonstructural protein V
    Species: Simian virus 5 [TaxId:11207]
    Gene: P/V
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2b5lc_
  • Chain 'D':
    Compound: Nonstructural protein V
    Species: Simian virus 5 [TaxId:11207]
    Gene: P/V
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d2b5ld_
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b5lA (A:)
    msynyvvtaqkptavngcvtghftsaedlnlliakntrleiyvvtaeglrpvkevgmygk
    iavmelfrpkgeskdllfiltakynacileykqsgesidiitrahgnvqdrigrpsetgi
    igiidpecrmiglrlydglfkvipldrdnkelkafnirleelhvidvkflygcqapticf
    vyqdpqgrhvktyevslrekefnkgpwkqenveaeasmviavpepfggaiiigqesityh
    ngdkylaiappiikqstivchnrvdpngsryllgdmegrlfmlllekeeqmdgtvtlkdl
    rvellgetsiaecltyldngvvfvgsrlgdsqlvklnvdsneqgsyvvametftnlgpiv
    dmcvvdlerqgqgqlvtcsgafkegslriirngigihehasidlpgikglwplrsdpnre
    tydtlvlsfvgqtrvlmlngeeveetelmgfvddqqtffcgnvahqqliqitsasvrlvs
    qepkalvsewkepqaknisvascnssqvvvavgralyylqihpqelrqishtemehevac
    lditplgdsnglsplcaiglwtdisarilklpsfellhkemlggeiiprsilmttfessh
    yllcalgdgalfyfglnietgllsdrkkvtlgtqptvlrtfrslsttnvfacsdrptviy
    ssnhklvfsnvnlkevnymcplnsdgypdslalannstltigtideiqklhirtvplyes
    prkicyqevsqcfgvlssrievqdtsggttalrpsastqalsssvsssklfssstaphet
    sfgeevevhnlliidqhtfevlhahqflqneyalslvscklgkdpntyfivgtamvypee
    aepkqgrivvfqysdgklqtvaekevkgavysmvefngkllasinstvrlyewttekdvr
    tecnhynnimalylktkgdfilvgdlmrsvlllaykpmegnfeeiardfnpnwmsaveil
    dddnflgaenafnlfvcqkdsaattdeerqhlqevglfhlgefvnvfchgslvmqnlget
    stptqgsvlfgtvngmiglvtslseswynllldmqnrlnkviksvgkiehsfwrsfhter
    ktepatgfidgdliesfldisrpkmqevvanlqyddgsgmkreataddlikvveeltrih
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b5lA (A:)
    msynyvvtaqkptavngcvtghftsaedlnlliakntrleiyvvtaeglrpvkevgmygk
    iavmelfrpkgeskdllfiltakynacileykqsgesidiitrahgnvqdrigrpsetgi
    igiidpecrmiglrlydglfkvipldrdnkelkafnirleelhvidvkflygcqapticf
    vyqdpqgrhvktyevslrekefnkgpwkqenveaeasmviavpepfggaiiigqesityh
    ngdkylaiappiikqstivchnrvdpngsryllgdmegrlfmlllekeeqmdgtvtlkdl
    rvellgetsiaecltyldngvvfvgsrlgdsqlvklnvdsneqgsyvvametftnlgpiv
    dmcvvdlerqgqgqlvtcsgafkegslriirngigihehasidlpgikglwplrsdpnre
    tydtlvlsfvgqtrvlmlngeeveetelmgfvddqqtffcgnvahqqliqitsasvrlvs
    qepkalvsewkepqaknisvascnssqvvvavgralyylqihpqelrqishtemehevac
    lditplgdsnglsplcaiglwtdisarilklpsfellhkemlggeiiprsilmttfessh
    yllcalgdgalfyfglnietgllsdrkkvtlgtqptvlrtfrslsttnvfacsdrptviy
    ssnhklvfsnvnlkevnymcplnsdgypdslalannstltigtideiqklhirtvplyes
    prkicyqevsqcfgvlssrievqdtsggttalrpsastqalsssvsssklfsstsfgeev
    evhnlliidqhtfevlhahqflqneyalslvscklgkdpntyfivgtamvypeeaepkqg
    rivvfqysdgklqtvaekevkgavysmvefngkllasinstvrlyewttekdvrtecnhy
    nnimalylktkgdfilvgdlmrsvlllaykpmegnfeeiardfnpnwmsaveildddnfl
    gaenafnlfvcqkdsaattdeerqhlqevglfhlgefvnvfchgslvmqnlgstptqgsv
    lfgtvngmiglvtslseswynllldmqnrlnkviksvgkiehsfwrsfhterktepatgf
    idgdliesfldisrpkmqevvanlqyddgsgmkreataddlikvveeltrih
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b5lB (B:)
    msynyvvtaqkptavngcvtghftsaedlnlliakntrleiyvvtaeglrpvkevgmygk
    iavmelfrpkgeskdllfiltakynacileykqsgesidiitrahgnvqdrigrpsetgi
    igiidpecrmiglrlydglfkvipldrdnkelkafnirleelhvidvkflygcqapticf
    vyqdpqgrhvktyevslrekefnkgpwkqenveaeasmviavpepfggaiiigqesityh
    ngdkylaiappiikqstivchnrvdpngsryllgdmegrlfmlllekeeqmdgtvtlkdl
    rvellgetsiaecltyldngvvfvgsrlgdsqlvklnvdsneqgsyvvametftnlgpiv
    dmcvvdlerqgqgqlvtcsgafkegslriirngigihehasidlpgikglwplrsdpnre
    tydtlvlsfvgqtrvlmlngeeveetelmgfvddqqtffcgnvahqqliqitsasvrlvs
    qepkalvsewkepqaknisvascnssqvvvavgralyylqihpqelrqishtemehevac
    lditplgdsnglsplcaiglwtdisarilklpsfellhkemlggeiiprsilmttfessh
    yllcalgdgalfyfglnietgllsdrkkvtlgtqptvlrtfrslsttnvfacsdrptviy
    ssnhklvfsnvnlkevnymcplnsdgypdslalannstltigtideiqklhirtvplyes
    prkicyqevsqcfgvlssrievqdtsggttalrpsastqalsssvsssklfssstaphet
    sfgeevevhnlliidqhtfevlhahqflqneyalslvscklgkdpntyfivgtamvypee
    aepkqgrivvfqysdgklqtvaekevkgavysmvefngkllasinstvrlyewttekdvr
    tecnhynnimalylktkgdfilvgdlmrsvlllaykpmegnfeeiardfnpnwmsaveil
    dddnflgaenafnlfvcqkdsaattdeerqhlqevglfhlgefvnvfchgslvmqnlget
    stptqgsvlfgtvngmiglvtslseswynllldmqnrlnkviksvgkiehsfwrsfhter
    ktepatgfidgdliesfldisrpkmqevvanlqyddgsgmkreataddlikvveeltrih
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b5lB (B:)
    msynyvvtaqkptavngcvtghftsaedlnlliakntrleiyvvtaeglrpvkevgmygk
    iavmelfrpkgeskdllfiltakynacileykqsgesidiitrahgnvqdrigrpsetgi
    igiidpecrmiglrlydglfkvipldrdnkelkafnirleelhvidvkflygcqapticf
    vyqdpqgrhvktyevslrekefnkgpwkqenveaeasmviavpepfggaiiigqesityh
    ngdkylaiappiikqstivchnrvdpngsryllgdmegrlfmlllekeeqmdgtvtlkdl
    rvellgetsiaecltyldngvvfvgsrlgdsqlvklnvdsneqgsyvvametftnlgpiv
    dmcvvdlerqgqgqlvtcsgafkegslriirngigihehasidlpgikglwplrsdpnre
    tydtlvlsfvgqtrvlmlngeeveetelmgfvddqqtffcgnvahqqliqitsasvrlvs
    qepkalvsewkepqaknisvascnssqvvvavgralyylqihpqelrqishtemehevac
    lditplgdsnglsplcaiglwtdisarilklpsfellhkemlggeiiprsilmttfessh
    yllcalgdgalfyfglnietgllsdrkkvtlgtqptvlrtfrslsttnvfacsdrptviy
    ssnhklvfsnvnlkevnymcplnsdgypdslalannstltigtideiqklhirtvplyes
    prkicyqevsqcfgvlssrievqdtsggttalrpsastqalsssvsssklfsstsfgeev
    evhnlliidqhtfevlhahqflqneyalslvscklgkdpntyfivgtamvypeeaepkqg
    rivvfqysdgklqtvaekevkgavysmvefngkllasinstvrlyewttekdvrtecnhy
    nnimalylktkgdfilvgdlmrsvlllaykpmegnfeeiardfnpnwmsaveildddnfl
    gaenafnlfvcqkdsaattdeerqhlqevglfhlgefvnvfchgslvmqnlgetstptqg
    svlfgtvngmiglvtslseswynllldmqnrlnkviksvgkiehsfwrsfhterktepat
    gfidgdliesfldisrpkmqevvanlqyddgsgmkreataddlikvveeltrih
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b5lC (C:)
    mdptdlsfspdeinklietglntveyftsqqvtgtsslgkntippgvtglltnaaeakiq
    estnhqkgsvgggakpkkprpkiaivpaddktvpgkpipnpllgldstpstqtvldlsgk
    tlpsgsykgvklakfgkenlmtrfieeprenpiatsspidfkrgrdtggfhrreysigwv
    gdevkvtewcnpscspitaaarrfectchqcpvtcsecerdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b5lC (C:)
    lietglntveyftsqqvtgtsslgkntippgvtglltnapkiaivpaddktvpgkpipnp
    llgldstpstqtvldlsgktlpsgsykgvklakfgkenlmtrfieeprenpdfkrgrdtg
    gfhrreysigwvgdevkvtewcnpscspitaaarrfectchqcpvtcsecerdt
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2b5lD (D:)
    mdptdlsfspdeinklietglntveyftsqqvtgtsslgkntippgvtglltnaaeakiq
    estnhqkgsvgggakpkkprpkiaivpaddktvpgkpipnpllgldstpstqtvldlsgk
    tlpsgsykgvklakfgkenlmtrfieeprenpiatsspidfkrgrdtggfhrreysigwv
    gdevkvtewcnpscspitaaarrfectchqcpvtcsecerdt
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b5lD (D:)
    klietglntveyftsqqvtgtsslgkntippgvtglltnarpkiaivpaddktvpgkpip
    npllgldstpstqtvldlsgktlpsgsykgvklakfgkenlmtrfieepreidfkrgrdt
    ggfhrreysigwvgdevkvtewcnpscspitaaarrfectchqcpvtcsecerdt