>d1ru5a_ j.6.1.1 (A:) Peptide YY, PYY {Pig (Sus scrofa) [TaxId: 9823]} ypakpeapgedaspeelsryyaslrhylnlvtrqry