SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1oyvi_ (1oyv I:)

  1. Root: SCOP 1.75
  2. 888632Class g: Small proteins [56992] (90 folds)
  3. 894446Fold g.69: Plant proteinase inhibitors [100896] (1 superfamily)
    disulfide-rich small alpha+beta fold; topological similarity to the Ovomucoid domain III
  4. 894447Superfamily g.69.1: Plant proteinase inhibitors [100897] (1 family) (S)
  5. 894448Family g.69.1.1: Plant proteinase inhibitors [57486] (3 protein domains)
  6. 894459Protein Wound-induced proteinase inhibitor-II [90168] (1 species)
    two-domain inhibitor; consists of one continuous domain of canonical fold and one discontinuous, circularly-permutated domain
  7. 894460Species Tomato (Lycopersicon esculentum) [TaxId:4081] [90169] (2 PDB entries)
  8. 894469Domain d1oyvi_: 1oyv I: [87620]
    Other proteins in same PDB: d1oyva_, d1oyvb_
    complexed with ca

Details for d1oyvi_

PDB Entry: 1oyv (more details), 2.5 Å

PDB Description: Crystal structure of tomato inhibitor-II in a ternary complex with subtilisin Carlsberg
PDB Compounds: (I:) Wound-induced proteinase inhibitor-II

SCOP Domain Sequences for d1oyvi_:

Sequence, based on SEQRES records: (download)

>d1oyvi_ g.69.1.1 (I:) Wound-induced proteinase inhibitor-II {Tomato (Lycopersicon esculentum) [TaxId: 4081]}
kactrecgnlgfgicprsegsplnpicinccsgykgcnyynsfgkficegesdpkrpnac
tfncdpniaysrcprsqgksliyptgcttcctgykgcyyfgkdgkfvcegesdepk

Sequence, based on observed residues (ATOM records): (download)

>d1oyvi_ g.69.1.1 (I:) Wound-induced proteinase inhibitor-II {Tomato (Lycopersicon esculentum) [TaxId: 4081]}
kactrecgnlgfgicprsegsplnpicinccsgykgcnyynsfgkficegesdpkrpnac
tfncdpniaysrcgcttcctgykgcyyfgkdgkfvcegesdepk

SCOP Domain Coordinates for d1oyvi_:

Click to download the PDB-style file with coordinates for d1oyvi_.
(The format of our PDB-style files is described here.)

Timeline for d1oyvi_: