SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3abza3 (3abz A:388-559)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2078445Fold b.179: Anthrax protective antigen N-terminal-like [254104] (1 superfamily)
    core: sandwich; 10-12 strands in 2 sheets; jelly roll; may contain inserted subdomains
  4. 2078446Superfamily b.179.1: PA14-like [254123] (3 families) (S)
  5. 2078447Family b.179.1.1: PA14 [254147] (2 protein domains)
    Pfam PF07691
  6. 2078448Protein Beta-glucosidase PA14 domain [254417] (1 species)
  7. 2078449Species Kluyveromyces marxianus [TaxId:4911] [254858] (2 PDB entries)
  8. 2078450Domain d3abza3: 3abz A:388-559 [245086]
    Other proteins in same PDB: d3abza1, d3abza2, d3abza4, d3abzb1, d3abzb2, d3abzb4, d3abzc1, d3abzc2, d3abzc4, d3abzd1, d3abzd2, d3abzd4
    complexed with gol

Details for d3abza3

PDB Entry: 3abz (more details), 2.15 Å

PDB Description: Crystal structure of Se-Met labeled Beta-glucosidase from Kluyveromyces marxianus
PDB Compounds: (A:) Beta-glucosidase I

SCOPe Domain Sequences for d3abza3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abza3 b.179.1.1 (A:388-559) Beta-glucosidase PA14 domain {Kluyveromyces marxianus [TaxId: 4911]}
hksigglaesslidaakpadaensgliakfysnpveersddeepfhvtkvnrsnvhlfdf
khekvdpknpyffvtltgqyvpqedgdyifslqvygsglfylndeliidqkhnqergsfc
fgagtkertkkltlkkgqvynvrveygsgptsglvgefgaggfqagvikaid

SCOPe Domain Coordinates for d3abza3:

Click to download the PDB-style file with coordinates for d3abza3.
(The format of our PDB-style files is described here.)

Timeline for d3abza3: