SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2p8qa_ (2p8q A:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 921849Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 921850Superfamily a.118.1: ARM repeat [48371] (24 families) (S)
  5. 921851Family a.118.1.1: Armadillo repeat [48372] (7 protein domains)
  6. 921892Protein Importin beta [48378] (3 species)
  7. 921895Species Human (Homo sapiens) [TaxId:9606] [48379] (10 PDB entries)
  8. 921897Domain d2p8qa_: 2p8q A: [149314]
    automated match to d1qgka_

Details for d2p8qa_

PDB Entry: 2p8q (more details), 2.35 Å

PDB Description: Crystal Structure of human Importin beta bound to the Snurportin1 IBB-domain
PDB Compounds: (A:) importin beta-1 subunit

SCOPe Domain Sequences for d2p8qa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p8qa_ a.118.1.1 (A:) Importin beta {Human (Homo sapiens) [TaxId: 9606]}
melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
ayeaadvaddqeepatyclsssfelivqkllettdrpdghqnnlrssayeslmeivknsa
kdcypavqkttlvimerlqqvlqmeshiqstsdriqfndlqsllcatlqnvlrkvqhqda
lqisdvvmasllrmfqstagsggvqedalmavstlvevlggeflkymeafkpflgiglkn
yaeyqvclaavglvgdlcralqsniipfcdevmqlllenlgnenvhrsvkpqilsvfgdi
alaiggefkkylevvlntlqqasqaqvdksdydmvdylnelrescleaytgivqglkgdq
envhpdvmlvqprvefilsfidhiagdedhtdgvvacaagligdlctafgkdvlklvear
pmihelltegrrsktnkaktlatwatkelrklk

SCOPe Domain Coordinates for d2p8qa_:

Click to download the PDB-style file with coordinates for d2p8qa_.
(The format of our PDB-style files is described here.)

Timeline for d2p8qa_: