SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d2p8qa1 (2p8q A:1-485)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 775276Fold a.118: alpha-alpha superhelix [48370] (24 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 775277Superfamily a.118.1: ARM repeat [48371] (23 families) (S)
  5. 775278Family a.118.1.1: Armadillo repeat [48372] (6 protein domains)
  6. 775320Protein Importin beta [48378] (3 species)
  7. 775327Species Human (Homo sapiens) [TaxId:9606] [48379] (10 PDB entries)
  8. 775331Domain d2p8qa1: 2p8q A:1-485 [149314]
    automatically matched to d1m5ns_

Details for d2p8qa1

PDB Entry: 2p8q (more details), 2.35 Å

PDB Description: Crystal Structure of human Importin beta bound to the Snurportin1 IBB-domain
PDB Compounds: (A:) importin beta-1 subunit

SCOP Domain Sequences for d2p8qa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2p8qa1 a.118.1.1 (A:1-485) Importin beta {Human (Homo sapiens) [TaxId: 9606]}
melitilektvspdrleleaaqkfleraavenlptflvelsrvlanpgnsqvarvaaglq
iknsltskdpdikaqyqqrwlaidanarrevknyvlqtlgtetyrpssasqcvagiacae
ipvnqwpelipqlvanvtnpnstehmkestleaigyicqdidpeqlqdksneiltaiiqg
mrkeepsnnvklaatnallnsleftkanfdkeserhfimqvvceatqcpdtrvrvaalqn
lvkimslyyqymetymgpalfaitieamksdidevalqgiefwsnvcdeemdlaieasea
aeqgrppehtskfyakgalqylvpiltqtltkqdendddddwnpckaagvclmllatcce
ddivphvlpfikehiknpdwryrdaavmafgcilegpepsqlkplviqamptlielmkdp
svvvrdtaawtvgricellpeaaindvylapllqclieglsaeprvasnvcwafsslaea
ayeaa

SCOP Domain Coordinates for d2p8qa1:

Click to download the PDB-style file with coordinates for d2p8qa1.
(The format of our PDB-style files is described here.)

Timeline for d2p8qa1: