SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d1tqya2 (1tqy A:219-423)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 846958Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 846959Superfamily c.95.1: Thiolase-like [53901] (2 families) (S)
  5. 846960Family c.95.1.1: Thiolase-related [53902] (8 protein domains)
  6. 846961Protein Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA [110752] (1 species)
  7. 846962Species Streptomyces coelicolor [TaxId:1902] [110753] (1 PDB entry)
    Uniprot Q02059
  8. 846964Domain d1tqya2: 1tqy A:219-423 [107246]
    Other proteins in same PDB: d1tqyb1, d1tqyb2, d1tqyd1, d1tqyd2, d1tqyf1, d1tqyf2, d1tqyh1, d1tqyh2

Details for d1tqya2

PDB Entry: 1tqy (more details), 2 Å

PDB Description: The Actinorhodin Ketosynthase/Chain Length Factor
PDB Compounds: (A:) Beta-Ketoacyl synthase/Acyl transferase

SCOP Domain Sequences for d1tqya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1tqya2 c.95.1.1 (A:219-423) Actinorhodin polyketide putative beta-ketoacyl synthase 1, KasA {Streptomyces coelicolor [TaxId: 1902]}
ddpehasrpfdgtrdgfvlaegaamfvledydsalargarihaeisgyatrcnayhmtgl
kadgremaetirvaldesrtdatdidyinahgsgtrqndrhetaaykralgeharrtpvs
siksmvghslgaigsleiaacvlalehgvvpptanlrtsdpecdldyvplearerklrsv
ltvgsgfggfqsamvlrdaetagaa

SCOP Domain Coordinates for d1tqya2:

Click to download the PDB-style file with coordinates for d1tqya2.
(The format of our PDB-style files is described here.)

Timeline for d1tqya2: